PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013613998.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 249aa    MW: 28359.2 Da    PI: 8.8558
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013613998.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.31.3e-161057148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd ll +++ ++G g W+ ++ + g++R++k+c++rw++yl
   XP_013613998.1 10 KGAWTAEEDSLLRQCIDKYGEGKWHQVPLRAGLNRCRKSCRLRWLNYL 57
                     79********************************************97 PP

2Myb_DNA-binding47.93.1e-1563108148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+ + +E +ll++++k+lG++ W++Ia +++ gRt++++k++w+++l
   XP_013613998.1  63 KGKLSSDEVDLLLRLHKLLGNR-WSLIAGRLP-GRTANDVKNYWNTHL 108
                      678899****************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.184561IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-21660IPR009057Homeodomain-like
SuperFamilySSF466892.79E-287104IPR009057Homeodomain-like
SMARTSM007171.1E-14959IPR001005SANT/Myb domain
PfamPF002491.3E-151057IPR001005SANT/Myb domain
CDDcd001672.54E-101257No hitNo description
Gene3DG3DSA:1.10.10.602.3E-2261111IPR009057Homeodomain-like
PROSITE profilePS5129420.31862112IPR017930Myb domain
SMARTSM007171.7E-1462110IPR001005SANT/Myb domain
PfamPF002498.6E-1463108IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MEGSPKGLRK GAWTAEEDSL LRQCIDKYGE GKWHQVPLRA GLNRCRKSCR LRWLNYLKPS  60
IKKGKLSSDE VDLLLRLHKL LGNRWSLIAG RLPGRTANDV KNYWNTHLSK KHEPGCNTKM  120
RKRNIPCSST QPAQKNEVLK PRPRSFTVNN GCSHFNGQPK VDVIPLFLGV NNTNNVCENS  180
ITYKNDAEKY ELVNNLMDGE NMWWKSLLEE SQEPGAIVPE STETEKLATS AFDVEQLWNL  240
LDGETVEPD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-2281115107B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bol.141600.0leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM4034510.0KM403451.1 Brassica rapa cultivar Zi He anthocyanin R2R3-MYB transcription factor (MYB3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013613998.10.0PREDICTED: transcription factor MYB114-like
SwissprotQ9FE251e-129MYB75_ARATH; Transcription factor MYB75
TrEMBLA0A078IZV40.0A0A078IZV4_BRANA; BnaCnng28030D protein
TrEMBLA0A0D2ZRG60.0A0A0D2ZRG6_BRAOL; Uncharacterized protein
STRINGBra039763.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56650.11e-131production of anthocyanin pigment 1